PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016650517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 245aa    MW: 28210.9 Da    PI: 8.9079
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016650517.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-20968357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  XP_016650517.1  9 SRWCPTPEQLMILEEMYRAgIRTPNASQIQHITAQLslygKIEGKNVFYWFQNHKARDRQ 68
                    8*****************99*************************************996 PP

2Wus_type_Homeobox1192e-38769264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +++RW+PtpeQ++iLee+y++G+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
     XP_016650517.1  7 SSSRWCPTPEQLMILEEMYRAGIRTPNASQIQHITAQLSLYGKIEGKNVFYWFQNHKARDRQK 69
                       689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.398469IPR001356Homeobox domain
SMARTSM003895.9E-7673IPR001356Homeobox domain
PfamPF000464.2E-18968IPR001356Homeobox domain
SuperFamilySSF466891.67E-11969IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-8968IPR009057Homeodomain-like
CDDcd000868.35E-61069No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSPAANSSSR WCPTPEQLMI LEEMYRAGIR TPNASQIQHI TAQLSLYGKI EGKNVFYWFQ  60
NHKARDRQKL RRKLCKQLQQ QQLLYNHHHN YHNYHNNPYH HHHHQQQQQQ QSLLGYLDHL  120
SPPASSSTLQ QLSNCHNYSS AGFLPPPQGG VEDALMNHAW KMEIPQRVEM EKSVMSMYGR  180
DWMMMMMEDV GPPSPCCSTS TRTTTTRQPL KTLQLFPITA TNLKEESSPS SSNPLSPPTT  240
PTPNY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208702.11e-117hypothetical protein PRUPE_ppa019793mg
SwissprotQ9SIB41e-46WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLM5W9A31e-117M5W9A3_PRUPE; Uncharacterized protein
STRINGAT2G28610.13e-44(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.11e-40WOX family protein